SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008064 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008064
Domain Number 1 Region: 330-608
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-80
Family Kelch motif 0.000000844
Further Details:      
 
Domain Number 2 Region: 58-175
Classification Level Classification E-value
Superfamily POZ domain 3.41e-36
Family BTB/POZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008064   Gene: ENSOCUG00000009345   Transcript: ENSOCUT00000009347
Sequence length 621
Comment pep:novel chromosome:oryCun2:13:1073051:1143825:1 gene:ENSOCUG00000009345 transcript:ENSOCUT00000009347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVERAEGCFSWCMEGKPMRRCTNIRPGETGMDVTSRCTLGDPNKLPEGVPQPARMPYISD
KHPRQTLEVINLLRKHRELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTE
VVIRDIDERAMELLIDFAYTSQITVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPS
NCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSE
EQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVD
EAKNYLLLPQERPLMQGPRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMV
ASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGV
AVLGGFLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGS
DGTSPLNTVERYSPQENRWHTIAPTGTRRKHLSCAVYQDMIYAVGGRDDTTELSSAERYN
PRMNQWSPVVAMTSRQSGVGLAVVNGQLMAVGCFDGTTYLKTIEVFDPDANTWRLYGGMN
YRRLGGGVGVIKMTHCESHIW
Download sequence
Identical sequences ENSOCUP00000008064 9986.ENSOCUP00000008064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]