SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008260 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008260
Domain Number 1 Region: 267-537
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-82
Family Protein kinases, catalytic subunit 0.0000000000891
Further Details:      
 
Domain Number 2 Region: 154-298
Classification Level Classification E-value
Superfamily SH2 domain 3.7e-39
Family SH2 domain 0.00000125
Further Details:      
 
Domain Number 3 Region: 65-164
Classification Level Classification E-value
Superfamily SH3-domain 3.07e-22
Family SH3-domain 0.0000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008260   Gene: ENSOCUG00000009585   Transcript: ENSOCUT00000009583
Sequence length 544
Comment pep:novel chromosome:oryCun2:4:2800608:2815843:-1 gene:ENSOCUG00000009585 transcript:ENSOCUT00000009583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSKSKPRDASQRRRSLEPARERPTEGPDGAFPSTQTPNKPASADGHRGPSAAFAPAAA
EPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTWV
PLPLREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPR
GTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAY
YSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGT
TRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDF
LKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLAR
LIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNR
EVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQP
GENL
Download sequence
Identical sequences G1SXH7
ENSOCUP00000008260 9986.ENSOCUP00000008260 ENSOCUP00000008260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]