SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008404 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008404
Domain Number 1 Region: 249-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-81
Family Protein kinases, catalytic subunit 0.000000000214
Further Details:      
 
Domain Number 2 Region: 113-240
Classification Level Classification E-value
Superfamily SH2 domain 3.56e-37
Family SH2 domain 0.00000374
Further Details:      
 
Domain Number 3 Region: 67-134
Classification Level Classification E-value
Superfamily SH3-domain 1.37e-16
Family SH3-domain 0.0000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008404   Gene: ENSOCUG00000009751   Transcript: ENSOCUT00000009756
Sequence length 525
Comment pep:novel chromosome:oryCun2:4:7203042:7244247:-1 gene:ENSOCUG00000009751 transcript:ENSOCUT00000009756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGGRSSCEDPGCPPSEERAPRMGCMKSKFLQGGRKISKTEPSTNLHTTVYVPDPTSSIKP
VSRGGSPSYVCPLSPGSEDIIVVALFDYEAIHREDLSFQKGDQLVVLEESGEWWKARSLA
TQEEGYIPSNYVARVNSLETEEWFFKGISRKDAERHLLAAGNMLGSFMIRDSETTKGSYS
LSVRDYDPQQGDTVKHYKIRTLDSGGFYVSPRSTFGTLQELVAHYQKQRDGLCQQLSVPC
VAAKPQKPWEKDAWEIPRDSLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEA
FLAEANLMKTLQHDKLVRLHAVVTQEPIYIITEFMAKGSLLDFLKSEDGSQQPLPKLIDF
AAQIAEGMAYIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDTEYTAREGAKFPI
KWTAPEAINFGSFTIKSDVWSFGILLMEIITYGRIPYPGMSNPEVIRALEHGYRMPRPEH
CPEELYSIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences ENSOCUP00000008404 9986.ENSOCUP00000021661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]