SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010107 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010107
Domain Number 1 Region: 902-1097
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000303
Further Details:      
 
Domain Number 2 Region: 19-156
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-21
Family PDZ domain 0.018
Further Details:      
 
Domain Number 3 Region: 754-823
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000904
Family Pleckstrin-homology domain (PH domain) 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010107   Gene: ENSOCUG00000011758   Transcript: ENSOCUT00000011758
Sequence length 1202
Comment pep:novel chromosome:oryCun2:19:39939322:40010310:1 gene:ENSOCUG00000011758 transcript:ENSOCUT00000011758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGVAFCLVGIPPRPEPRPPQLPLGPRDGCSPGRPPPWQGPRTLLLRKSLQDGFGFTLRH
FIVYPPESAVHCSLKEEENGGRGGGPSPRHRLEPMDTIFVKNVKEDGPAHRAGLRTGDRL
VKVNGESVIGKTYSQVIALIQNSDDVLELAIMPKDEDILQLAYSQDAYLKGNQPYSGEAR
SIPEPPPVCYPRKSYAPPARVSAWATMVPEPVSALPNDPRSPAAWSDQGPRVPAATRAHP
DNSCLGMSQPRPSPGAFPNLPSESRTPRAFPEPGSRVPPSRRQCQQALSHWLSNQVPRRA
GERRCPAMPPRARSASQDRLEDVTAHRPWPCSTSQDALSQLGQEGWHRARSDDYLGRATR
SAEALGPGALVSPRLERCGWASQRPAARTSACPSRDLPGPQAAPLSGLQGLDDVGYIGYR
SYSPSFQRRTGLLHALSFRDSPFGGLPSFSLAQTPAPFPPEASEPAARVVRPEPSPRALE
PPTEDHRDEVVLRQKPPTGRKVQLTPARQANLGIGDETPEPEPSGRGPRLGRKVAPLATT
EDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFALGRHYSQ
DCSSIKAGRRSSYLLAITTERSKSCDDGLNTFRDEGRVLRRLPNRVPSLRMLRSFFTDGS
LDSWGTSEDAEAPSKRPSTSDLSDANFSDIRREGWLYYKQILTKKGKVRRAEAWGSGPXX
XXXXALALAEQERQEPGPAATEAATAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTT
ADFCEYLFQAEDRDDMLSWIRAIRENSRAEGEDPGCANQALISKKLNEYRKVSHSSGPKA
DSSPKGSRGLGGLKSEFLKQSAARGLRTQELPAAGKDDSAAAPKTPWGINIIKKNKKAAP
RAFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRG
PSDINLQDERWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIEANRIEDARERMKTLRKL
IRDLPAHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTHMP
DRYKIVETLIQHSDWFFSDDEDKGERTPVDDKEPQSVPNIEYLLPNIGRTVPPGDPGSDS
TTCSSAKSKGSWAPKKEPYAREMLAISFISAVNRKRKKRREARGLGSSTDDDSEQEAHKP
GA
Download sequence
Identical sequences ENSOCUP00000010107 9986.ENSOCUP00000010107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]