SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011386 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011386
Domain Number 1 Region: 224-490
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-76
Family Protein kinases, catalytic subunit 0.00000000389
Further Details:      
 
Domain Number 2 Region: 114-256
Classification Level Classification E-value
Superfamily SH2 domain 9.11e-38
Family SH2 domain 0.00000279
Further Details:      
 
Domain Number 3 Region: 52-138
Classification Level Classification E-value
Superfamily SH3-domain 2.14e-20
Family SH3-domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011386   Gene: ENSOCUG00000013226   Transcript: ENSOCUT00000013225
Sequence length 500
Comment pep:novel chromosome:oryCun2:2:38416500:38435810:-1 gene:ENSOCUG00000013226 transcript:ENSOCUT00000013225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLVGSKKQVKEKGKSHWSPATVSAQSKAPPPLPPLVVLNHLDPPPPSELPEQEGHFVVA
LYDYAAVNDQDLHMVRGEKLQILQETGDWWLARSLVTGKEGYVPSNFVAGVESLEVEKWF
FKSISRKEAERQLLAPVNKAGSFLIRESETSQGAFSLSVKDASPQGEVVKHYKIRSLDEG
GYYISPRATFPSLQALVEHYSEKGDGLCQRLTLPCVGVAPQSPWAQDEWEIPRQSLKLVR
KLGSGQFGEVWMGYYKNNVKVAIKTLKEGTMSPEAFLGEANLMKTLQHERLVRLYAVVTR
EPIYIVTEYMARGCLLDFLKTDEGSKLSLPRLIDMSAQIAEGMAYIEHMNSIHRDLRAAN
ILVSEALSCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIQFGVFTIKADVWSFGILL
MEIVTYGRVPYPGMSNPEVIRSLERGYRMPRPDSCPPELYRDVIAECWRDRPEERPTFEF
LQSVLEDFYTATERQYELQP
Download sequence
Identical sequences G1T504
ENSOCUP00000011386 ENSOCUP00000011394 XP_002709485.1.1745 9986.ENSOCUP00000011394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]