SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012547 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012547
Domain Number 1 Region: 59-165
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 328-427
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 437-552
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 4 Region: 205-306
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012547   Gene: ENSOCUG00000014596   Transcript: ENSOCUT00000014596
Sequence length 776
Comment pep:novel scaffold:oryCun2:GL018937:274632:334418:-1 gene:ENSOCUG00000014596 transcript:ENSOCUT00000014596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPLGSCPRCCLAVLVLLPALSLAHYESWPSSLQYPEYFQQPAPEYQQPQVPSDVVKIQ
LRLAGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTTSSSYGRG
EGPIWLDNVHCTGKEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSVFNQIE
NLNIQVEDIRIRPVLSAFQHRSPVTEGFVEVKEGKTWKQICDKHWTAKNAHVVCGMFGFP
GERTYNAKAYKVVARRKKLRYWPFSMDCTGTEAHISSCKLGPQVSLHPTKNITCENGQPA
VVSCVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAQVGEGRVEVLRNGEWGTICDDKWDL
VSASVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIECTGSEKSIVDCKFNAKSEGCSHE
EDAGVRCNIPAMGFQKKLRLNGGRNPFEGRVEVLTKRNGSLVWGTVCGENWGIVEAMVVC
RQLGLGFASNAFQETWYWHGDVYSNKVVMSGVKCSGTELSLEHCRHDEDVSCPQGGVQYG
AGVACSETAPDLVLNAEMVQQTAYLEDRPMIMLQCAMEENCLSASAALTDRNTGYRRLLR
FSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAQGHKASFCL
EDTECEGDIQKSYECANFGEQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNY
EVSESDYSNNIMKCRCRYDGHRIWMYNCHIGGSFSDETEQKFEHFSGLLNNQLSTQ
Download sequence
Identical sequences ENSOCUP00000012547 9986.ENSOCUP00000012547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]