SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012878 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012878
Domain Number 1 Region: 450-557
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-30
Family SH2 domain 0.000000711
Further Details:      
 
Domain Number 2 Region: 127-222
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-28
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 249-375
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000685
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012878   Gene: ENSOCUG00000014985   Transcript: ENSOCUT00000014985
Sequence length 560
Comment pep:novel scaffold:oryCun2:GL018745:1966634:2034179:-1 gene:ENSOCUG00000014985 transcript:ENSOCUT00000014985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGPGVPSSREALALSPAEDDDLEKLVNDMNTSLESLYSACSNMQSDTVPLLQNGQHTRS
PPPAASARPAPPQKVQRSQPVHILAVRRLQDEDPQFRTSSLPAIPNPFPELSGPGSSPVL
PPASLPPSQPVTKQDVKVFSEDGTSKVVEILTDMTARDLCQLLIYRSHCVDDNSWTLVEH
HPHLGLERCLEDHELVVQVEGTMGSEGKFLFRKNYAKYEFFRNPVNFFPEQMVTWCQQSN
GSHTQLLQNFLNASSCPEIQGFLHVKELGRKSWKRLYVCLRRSGLYCSTKGTSKEPRHLQ
LLADLEESNIFSLISGKKQYSAPTDHGLCIKPNKVRNEIKELRLLCAEDEQSRICWMTAF
RLLKYGMLLYQNYRIPQQRKALLAPFATPVRSVSENSLVAMDFSGQTGRVIENPAEAQSA
ALEEGHAWRKRSTRMNILSSQSPLHPNSFSTVIHRTQHWFHGRISREESHRIIKQQGLVD
GLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFLSLDDGNTRFSDLIQLVDFY
QLNKGVLPCKLKHHCIRVAL
Download sequence
Identical sequences 9986.ENSOCUP00000012878 ENSOCUP00000012878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]