SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013051 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013051
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily DEATH domain 2.88e-27
Family DEATH domain, DD 0.0000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013051   Gene: ENSOCUG00000015189   Transcript: ENSOCUT00000015184
Sequence length 107
Comment pep:novel scaffold:oryCun2:GL019274:25488:25808:1 gene:ENSOCUG00000015189 transcript:ENSOCUT00000015184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLRVAFDIVCDNVGREWRRLARQLQVSDAKIDGIEERFPRNLSERVRAALRVWKDAQKEG
ATVARLVEALRRCGMNLVADLVEEEQQARGARDQGGAVSPMSWDSGA
Download sequence
Identical sequences G1T8W9
9986.ENSOCUP00000013051 ENSOCUP00000013051 ENSOCUP00000013051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]