SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013149 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013149
Domain Number 1 Region: 209-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000599
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 179-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000314
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 5-33
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000017
Family KRAB domain (Kruppel-associated box) 0.0056
Further Details:      
 
Domain Number 4 Region: 289-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000256
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013149   Gene: ENSOCUG00000015309   Transcript: ENSOCUT00000015305
Sequence length 335
Comment pep:novel scaffold:oryCun2:GL018890:130330:134235:-1 gene:ENSOCUG00000015309 transcript:ENSOCUT00000015305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRASPFKDMILCFSEEDWSLLDPGQTGFYGEFIIGEDCGVSVTPTDDPAALPGPFQGEER
ELLPELLELQGKEAPQASPTVPCKDLPALQLFEVEERRKWDELQVLESQAFQQTALPPST
QPAGGGPQILENGLQEEEEEVTIEIVLSSSGDEDSQHSPHGPQPCQGSEEIAGEVPASRK
AYVCPACGKAFCWRVNFVRHLRSRWDREKPHVCPVCGKLFSEGEDLDGHLEAHEAQKPYR
CGSCERSFHLNSHLLSHRRIHRQPSRLEPEKQSEEGLGFQHREPLAWHRGHTHQKDAMWP
FQCRYCVKSFGQNSDLLRHERVHMKRRSKQALNSY
Download sequence
Identical sequences ENSOCUP00000013149 9986.ENSOCUP00000013149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]