SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013226 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013226
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000044
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.66e-30
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 430-491
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000017
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013226   Gene: ENSOCUG00000015393   Transcript: ENSOCUT00000015392
Sequence length 503
Comment pep:novel chromosome:oryCun2:X:33354740:33362022:1 gene:ENSOCUG00000015393 transcript:ENSOCUT00000015392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPVGGRPGGRGAPEVKQNIPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQAFRALVQEKIQKRNQRKSGDRRQLPPPPAPANEERRGGLPPLPSH
PGGDQGGPQTGPLSLGLVTVDIQNPDITSSRYRGLPAPAPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQAPTEPPPPPSRGGNQPPRPPLAGGNKGRSGPLPPVPLGGAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPPPPPPPGAGGPAIPPPPPPPPPPPPSSGDGPVPPPPPLAP
LSGGCMASGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQTSEGLVGALMHVMQKRSR
AIHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences 9986.ENSOCUP00000013226 ENSOCUP00000013226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]