SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013239 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013239
Domain Number 1 Region: 39-213
Classification Level Classification E-value
Superfamily PH domain-like 9.43e-58
Family Phosphotyrosine-binding domain (PTB) 0.000000178
Further Details:      
 
Domain Number 2 Region: 381-488
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-26
Family SH2 domain 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013239   Gene: ENSOCUG00000015412   Transcript: ENSOCUT00000015409
Sequence length 496
Comment pep:novel chromosome:oryCun2:1:78578276:78750981:1 gene:ENSOCUG00000015412 transcript:ENSOCUT00000015409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGSCSAPSLDARTASAAPRPAAVSMSASRKGRPGDEPLPRPRGAPHASDQVLGPGVTYVV
KYLGCIEVLRSMRSLDFSTRTQITREAISRVCEAVPGAKGAFRKRKPPSKMLSSILGKSN
LQFAGMSISLTVSTASLNLRTPDSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNR
RACHILECCDGLAQDVIGSIGQAFELRFKQYLQCPSKIPVLQDRMQSLDEPWTEEEGEGS
DHPYYNSVPSKMPPPGGFLDARLKNRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQAP
VRQGSLDIYSTPEGKPHMAPAGEAPTYVNTQRMPPQAQPAATSSAESSPRRDLFDMKPFE
DALKNQSLGPVLNKAASVECISPVSPRAPDAKMLETLQAEPWYQGEMSRKEAEGLLEKDG
DFLVRKSTTNSGSFVLTGMHNGQAKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSVPI
VSAGSELCLQQPVERR
Download sequence
Identical sequences G1T9D4
9986.ENSOCUP00000013239 ENSOCUP00000013239 ENSOCUP00000013239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]