SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013916 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013916
Domain Number 1 Region: 128-317
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-63
Family Phosphotyrosine-binding domain (PTB) 0.00000000616
Further Details:      
 
Domain Number 2 Region: 473-577
Classification Level Classification E-value
Superfamily SH2 domain 7.54e-28
Family SH2 domain 0.00000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013916   Gene: ENSOCUG00000016188   Transcript: ENSOCUT00000016190
Sequence length 584
Comment pep:novel chromosome:oryCun2:13:37693563:37698924:1 gene:ENSOCUG00000016188 transcript:ENSOCUT00000016190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRLGPKGEPGRAAEDGEGITGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCGRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEELPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGTVRPAPPSAQTPSHLGATLPVGQPVGGDPEVRKQMPPQPPCPAGR
ELFDDPSYVNVQNLDKARQAGGGAGPPNATANGSAPRDLFDMKPFEDALRVPAPPQSVSM
AEQLQREPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
Download sequence
Identical sequences ENSOCUP00000013916 9986.ENSOCUP00000013916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]