SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015269 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015269
Domain Number 1 Region: 374-643
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-77
Family Protein kinases, catalytic subunit 0.0000000148
Further Details:      
 
Domain Number 2 Region: 5-145
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-43
Family Pleckstrin-homology domain (PH domain) 0.0000451
Further Details:      
 
Domain Number 3 Region: 270-416
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-33
Family SH2 domain 0.0000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015269   Gene: ENSOCUG00000017771   Transcript: ENSOCUT00000017777
Sequence length 653
Comment pep:novel chromosome:oryCun2:X:1347783:1391803:1 gene:ENSOCUG00000017771 transcript:ENSOCUT00000017777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEDSRSQWLKALQKEIRGNPHLLIKY
HSGFFVDGKYLCCQQTCKAAPGCTLWEAYADLHVAINEEKQRAPTFPDRVLKIPRAVPIL
KMDVPSSSTSLVKYDSDSRRNYVSQPNVNMGCIPREDCPDWWQVRKLKSLCSSDDVACSS
QTGRSVTNHSISKISWGFPESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFMV
RNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNGENKLYLAENYCFDSIPKLIHYHQHNS
AGMITRLRHPVSTKANKVPVSVSLGSGIWELKREEITLLKELGSGQFGVVQLGKWKGQYD
VAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKKYPIYIVTEYITNGCLLNYL
KSHGKGLEPSQLLEMCYNVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTRYV
LDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQV
VVKVSQGHRLYRPQLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLLEKDK
Download sequence
Identical sequences 9986.ENSOCUP00000015269 ENSOCUP00000015269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]