SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015554 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015554
Domain Number 1 Region: 147-284
Classification Level Classification E-value
Superfamily TNF-like 9.53e-38
Family TNF-like 0.0003
Further Details:      
 
Domain Number 2 Region: 50-55
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000015554
Domain Number - Region: 4-75
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0863
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015554   Gene: ENSOCUG00000028219   Transcript: ENSOCUT00000030640
Sequence length 284
Comment pep:novel chromosome:oryCun2:13:272823:279450:1 gene:ENSOCUG00000028219 transcript:ENSOCUT00000030640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQPFSYPYPQIYWVDSTASSPWAPPGSVLPCPSSVPERPGQRRPPPPLPPPPPPLPPPP
LPPLPPLPPLPPPPLKKRKDHSTGLCLLLMFFMVLVALLIGLGCPALPPAEELAELRESF
SQRHTASSSMEKQTAHPSPPQEKKETKKVAHLTGKSNSRSNPLEWEDTYGIALVSGLKYK
KGNLVINDTGLYFVYSKVYFRGQSCSNQPLTHKVYMKNSKYHQDLMLMEEKMMNYCTTGQ
MWARSSYLGAVFNLTSADHVYVNVSEISLVNFEESKTFFGLYKL
Download sequence
Identical sequences G1TYP4
9986.ENSOCUP00000022211 ENSOCUP00000022211 ENSOCUP00000015554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]