SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018605 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018605
Domain Number 1 Region: 134-242
Classification Level Classification E-value
Superfamily SRCR-like 8.76e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 238-343
Classification Level Classification E-value
Superfamily SRCR-like 8.63e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 
Domain Number 3 Region: 23-138
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018605   Gene: ENSOCUG00000012464   Transcript: ENSOCUT00000026010
Sequence length 651
Comment pep:novel chromosome:oryCun2:1:193620443:193630906:1 gene:ENSOCUG00000012464 transcript:ENSOCUT00000026010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFTAPSGQPDASHTQSKLSEPAERFRLRLVSGSSRCSGTVEVWFGEAWKAACGALWDGRA
AEAACRVLGCGGAEAAVQPAPSSPTLPPRPAAGNSSQTANATLPVVQCSGAEWRLCEVVS
QACSSDGRPAQVTCAEHRALRLVDGGSPCAGRVEMLEYGRWGSVCDDTWDLEDAHVVCRQ
LGCGWAVQALPGLHFAPGQGPIHRDQVNCSGDETYLWDCPGTPGEHYCGHKEDAGVVCSE
HQSWRLTGGADRCEGQVEVHFRGVWSTVCDSEWYSPEASVLCRALGCGTLVDRPRGLPHS
LSGRMYYSCEGGEPTLSNCSWRFNNSNLCSQSHAARVLCSGSRSLHNLSTPEVPASVQPA
SVEPSVTVKMEDKESQELALLIPCIVLGVLLLASLISIAFILFRIKGKYALPVTMNHQHL
PTTIPAGTNSYKAVPITIPKEEVPKLPIQVRAQPAEDSDSSSDSDYEHYDFSAQPPVALT
TFYNSQRHRVTEDEAQQRRFQMPPLEEAQLPWRHSSHRPPWVLPAANPIADAPSLGPQHQ
HRSQSESSTSSGEDYCNSPSSKPPAWSLQGFPSERSPLLEQPPNLELAGPQAACPAGPLA
DDSSSTSSGEWYQNFQPPPQPPPVEQFGCPGPPSPQADSTSEDDYDDIGAA
Download sequence
Identical sequences ENSOCUP00000018605 9986.ENSOCUP00000010729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]