SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018786 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018786
Domain Number 1 Region: 129-185
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000467
Family Phosphotyrosine-binding domain (PTB) 0.0014
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily PH domain-like 0.000000109
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018786   Gene: ENSOCUG00000020947   Transcript: ENSOCUT00000021084
Sequence length 196
Comment pep:novel scaffold:oryCun2:GL018798:743002:744620:1 gene:ENSOCUG00000020947 transcript:ENSOCUT00000021084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKWRRFGAVLYAESGCALARLELQEGPEKTRRGDAGRRVIRLSDCLRVAEAGSEASSPRD
TSAFLLETKERLYLLAAPTAERSDWLQAICLLAFPGQRKELQAPEGKSAHPHMEINKLYS
RPTVVPCKEFAVTMRPTEASERCRLRGSYILRAGENALELWGGSEPGTPLFHWPYRFLRR
FGRDKVSESASQVGRK
Download sequence
Identical sequences ENSOCUP00000018786 9986.ENSOCUP00000018786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]