SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019966 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019966
Domain Number 1 Region: 308-507
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-56
Family Kelch motif 0.00000948
Further Details:      
 
Domain Number 2 Region: 35-151
Classification Level Classification E-value
Superfamily POZ domain 2.69e-35
Family BTB/POZ domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019966   Gene: ENSOCUG00000003760   Transcript: ENSOCUT00000024629
Sequence length 593
Comment pep:known scaffold:oryCun2:GL018701:8205948:8328991:1 gene:ENSOCUG00000003760 transcript:ENSOCUT00000024629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVSPVVWYRCTKQGHQKPLDSKDDSTEKHCPVTVNPWHMKKAFKVMNELRSQNLLCDVTI
VAEDMEISAHRVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDGWTLRMLIDYVYTAEIQ
VTEENVQVLLPAAGLLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTY
AEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVNHDKDVRQEFMAR
LMEHVRLPLLPREYLVQRVEEEALVKNSSACKDYLIEAMKYHLLPTEQRLLMKSVRTRLR
TPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYMAGLVFAVGG
FNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAY
NIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDGASRQCLSTVESYNATTNEWTYIA
EMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNTWRQVADMNMCRRNAGVCA
VNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSCMSTGRSYAGVTVIDKPL
Download sequence
Identical sequences ENSOCUP00000019966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]