SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020505 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000020505
Domain Number - Region: 46-100
Classification Level Classification E-value
Superfamily DEATH domain 0.00647
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020505   Gene: ENSOCUG00000010338   Transcript: ENSOCUT00000010337
Sequence length 188
Comment pep:novel chromosome:oryCun2:1:70814530:70818977:-1 gene:ENSOCUG00000010338 transcript:ENSOCUT00000010337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAPTCVPDQTYCDRLVQDTPFLTGRGRLSEQQVDRIILQLNRYYPQILTDKQAEKFRNPK
ASLRLRLCDLLSHLQHSGERDCQEFYRALYIHAQPLHGLLPSRQALQNSDCTELDWGRES
HELSDRGPMSFLAGLGLAAGLALLLYCCPPDSRGLPGARRLLGFSPVIVDRHVSRYLLAF
LADDLGGL
Download sequence
Identical sequences G1TTY2
ENSOCUP00000020505 9986.ENSOCUP00000020505 ENSOCUP00000020505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]