SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020548 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020548
Domain Number 1 Region: 324-614
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-77
Family Kelch motif 0.0000844
Further Details:      
 
Domain Number 2 Region: 8-62,119-183
Classification Level Classification E-value
Superfamily POZ domain 1.49e-28
Family BTB/POZ domain 0.005
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000020548
Domain Number - Region: 74-108
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00102
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020548   Gene: ENSOCUG00000008583   Transcript: ENSOCUT00000031765
Sequence length 630
Comment pep:novel chromosome:oryCun2:9:74010947:74107142:-1 gene:ENSOCUG00000008583 transcript:ENSOCUT00000031765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRS
LFSSHPPLGGGGVGGQDGLGAPKDQQQPPPQQQQPQQQPPPPQEEPGTPSSSPDDKLLTS
PRAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLN
DQISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNFEEMRALLDSLPPPVESELAL
FQMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAM
NYHLMPFRQHCRQSLASRIRSNKKMLLLVGGLPPGPDRLPSNLVQYYDDEKKTWKILTIM
PYNSAHHCVVEVENFLFVLGGEDQWNPNGKHSTNFVSRYDPRFNSWIQLPPMQERRASFY
ACRLDKHLYVIGGRNETGYLSSVECYNLETNEWRYVSSLPQPLAAHAGAVHNGKIYISGG
VHNGEYVPWLYCYDPVMDVWARKQDMNTKRAIHTLAVMNDRLYAIGGNHLKGFSHLDVML
VECYDPKGDQWNILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYKSSTICYCPEKGT
WTELEGDVAEPLAGPACATVILPACVPYNK
Download sequence
Identical sequences G1SVG1
XP_017199591.1.1745 ENSOCUP00000020548 ENSOCUP00000007417 9986.ENSOCUP00000007417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]