SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020938 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020938
Domain Number 1 Region: 117-200
Classification Level Classification E-value
Superfamily SH2 domain 1.71e-39
Family SH2 domain 0.0000373
Further Details:      
 
Domain Number 2 Region: 32-116
Classification Level Classification E-value
Superfamily EF-hand 3.95e-37
Family EF-hand modules in multidomain proteins 0.00015
Further Details:      
 
Domain Number 3 Region: 225-286
Classification Level Classification E-value
Superfamily RING/U-box 2.7e-30
Family RING finger domain, C3HC4 0.00039
Further Details:      
 
Domain Number 4 Region: 1-30
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 0.0000000000144
Family N-terminal domain of cbl (N-cbl) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020938   Gene: ENSOCUG00000024783   Transcript: ENSOCUT00000022099
Sequence length 385
Comment pep:novel scaffold:oryCun2:GL019011:38262:46435:1 gene:ENSOCUG00000024783 transcript:ENSOCUT00000022099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRQLAKLALIFSHMHAELHALFPGGKYRGHEYQLTKAPAQALWRAHCGARCVLPWAEFES
LLGTCHPVEPGPTALALRSTVDLTCSGHVSIFEFDIFTRLFQPWPTLLKNWQLLAVNHPG
YMAFLTYDEVQTRLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSVVQTIPPNKPLFQV
LLKGQKEGITPPPSPLDFNPWKKKMCLFERYINKSLEKERKARRRSMDSTFELCKICAER
NKDVRIEPCGHLLCSHCLGAWQHSDSRTCPFCRCEIQGREAISIYQPLGEPAAQGAQGDS
SSPEDSEPEPELEPEPAAPSAPPLPPRLGPSPRRPTSEGGLTVAPPALPRLRHPLPLPRM
TTLASAPWEVPACPQAGEGATGESQ
Download sequence
Identical sequences G1TV56
ENSOCUP00000020938 ENSOCUP00000020938 9986.ENSOCUP00000020938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]