SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021542 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021542
Domain Number 1 Region: 56-187
Classification Level Classification E-value
Superfamily PH domain-like 2.73e-27
Family Phosphotyrosine-binding domain (PTB) 0.0083
Further Details:      
 
Domain Number 2 Region: 310-417
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000221
Family SH2 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021542   Gene: ENSOCUG00000022310   Transcript: ENSOCUT00000007118
Sequence length 462
Comment pep:novel chromosome:oryCun2:13:132304982:132392688:1 gene:ENSOCUG00000022310 transcript:ENSOCUT00000007118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTCISRQSAWIGLLALSSDPTLLLIQTPFFLWTLKLGTLGAMQRAGAGGRRASDCGPAPY
RPRCITKFAQYVGSFPVDDLDTQESVWLVQQQLWTLKDCPRRRAVILKFSLQGLKIYSGE
GEVLLMAHALRRILYSTWCPADCQFAFVARNPRSPASKLFCHLFVGSQPGEVHILYLLLC
RSFQLAYLLQHPEERAQPEPSPAPTADVPPKPLGGPPALAREPFGRDQLSQNVHALVSFR
RLPAEGPVGSGKELLESEGRGGARHARLGNPYCSPTLVRKKAIRSKVIRSGAYRGCTYEA
QLQLSAREAFPAAWEAWPRGPGGPSCLVESEGSLTENIWAFAGISRTCALALLRRDVLGA
FLLWPEPGASGQWCLSVRTQCGVVPHQVFRNPLGRYCLERLPADFPSLEALVENRAGAKR
SLFCPLGMGRLNPTYEEQDSGPPRTLRPLGHAKSEAELQGLG
Download sequence
Identical sequences 9986.ENSOCUP00000021542 ENSOCUP00000021542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]