SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021943 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021943
Domain Number 1 Region: 341-633
Classification Level Classification E-value
Superfamily Kelch motif 1.12e-76
Family Kelch motif 0.0000155
Further Details:      
 
Domain Number 2 Region: 69-189
Classification Level Classification E-value
Superfamily POZ domain 8.63e-32
Family BTB/POZ domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000021943
Domain Number - Region: 270-349
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0994
Family B3/B4 domain of PheRS, PheT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021943   Gene: ENSOCUG00000001993   Transcript: ENSOCUT00000001991
Sequence length 655
Comment pep:novel chromosome:oryCun2:X:66535307:66592505:-1 gene:ENSOCUG00000001993 transcript:ENSOCUT00000001991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGSSEMGLSSHLQS
SKAGTTRIFTSNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFK
AMFTGGMKEQDLMCIKLHGVSKVGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVL
DFCKVFLISGITLDNCVEVGRIANTYNLTEVDKYINSFVLKNFPALLSTGEFLKLPFERL
AFVLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMKNIRFPLMTPQELINYVQTVD
FMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHLVTLGGVLRQQLVVSKELR
MYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNK
WMQVASLNEKRTFFHLSALKGYLYAVGGRNAAGELPTVECYNPRTNEWTYVAKMSEPHYG
HAGTVYGGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVI
GGNHFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNR
CMVEIVQKYDPDKDEWHKVFDLPESLGGIRACTLTVFPPEETTPSPSRESPLSAP
Download sequence
Identical sequences G1TXY5
XP_008271137.1.1745 XP_017205473.1.1745 ENSOCUP00000021943 ENSOCUP00000021943 9986.ENSOCUP00000021943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]