SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022006 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022006
Domain Number 1 Region: 38-229
Classification Level Classification E-value
Superfamily L domain-like 5.35e-39
Family Ngr ectodomain-like 0.003
Further Details:      
 
Domain Number 2 Region: 246-342
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000096
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022006   Gene: ENSOCUG00000022007   Transcript: ENSOCUT00000026843
Sequence length 425
Comment pep:novel scaffold:oryCun2:GL019108:109622:110937:1 gene:ENSOCUG00000022007 transcript:ENSOCUT00000026843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPELRLLCWAALLGMARACPEPCDCGEKYGFQIADCAYRDLEAVPHGFPANVTTLSLSAN
RLPSLPEGAFREVPLLQSLWLAHNEIRRVAAGALASLGQLKSLDLSHNLLSDFAWSDLHA
LGALQLLKLDSNELTAIPRDAFHSLRALRSLQLNHNRLHTLAEGTFAPLTALSHLQINDN
PFDCTCGIVWLKAWALATAVSIPEQDNVACSSPHVLKGTPLSRLPPLPCSAPSAQLSYQP
SQDGTELRPGFVLALHCDTDGQPAPQLHWHIQTSGGTMEIASPNVGPDGRALAASGQPRF
RAFANGSLLIPGFGKPDEGTYSCLATNELGSAQSSVNVALAAPGEGGEDALGRRFHSKAA
ESRGCYTVDNEVQPSGPEDSVVIIYLSRPGSPEAAVVGEAVPGPRPPGLLLLGQRCLLAP
HQHPW
Download sequence
Identical sequences ENSOCUP00000022006 9986.ENSOCUP00000022006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]