SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022840 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022840
Domain Number 1 Region: 31-315
Classification Level Classification E-value
Superfamily L domain-like 3.51e-63
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 235-479
Classification Level Classification E-value
Superfamily L domain-like 4.76e-37
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 3 Region: 540-831
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.29e-33
Family Rhodopsin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022840   Gene: ENSOCUG00000004061   Transcript: ENSOCUT00000021067
Sequence length 951
Comment pep:novel chromosome:oryCun2:1:166337926:166365245:-1 gene:ENSOCUG00000004061 transcript:ENSOCUT00000021067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPLGLLCFLALGLLGSAGLSGAAPPLCAALCSCDGDRRVDCSGKGLTAVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTV
PSEAIRGLSTLQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSHLPTLQ
ALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIKSLSPHCFDGLDNLETLDLNYNNLGEF
PQAIKALPSLKELGFHSNSISVIPDGAFGGNPLLRTIHLYDNPLSFVGNTAFHNLSDLHS
LVIRGASMVQSFPNLTGTVHLESLTLTGTKISKIPSNLCQEQKMLRTLDLSYNNIRDLPS
FNGCHALEEISLQRNQIYQIKEGTFQGLGSLRILDLSRNLIHEIHSRAFAKLGPITNLDM
SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYA
NINTEDNSLQDHPVTKEKGTADAANVTSSAENEEHSQIIIHCTPSTGAFKPCEYLLGSWM
IRLTVWFIFLVALSFNLLVTLTTFASCTSLPSSKLFIGLISVSNLFMGIYSGILTFLDAV
SWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLVLAAVERSLSAKEIMKNGKSNHLK
QFRVAALFAFLGAAVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL
MAIIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPE
IMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRLTKKNGSVSVSISSQGGCVEQD
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCG
TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD
Download sequence
Identical sequences G1SL01
9986.ENSOCUP00000003521 ENSOCUP00000003521 ENSOCUP00000022840 XP_002709069.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]