SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023727 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023727
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.07e-31
Family Hormone receptor domain 0.00000364
Further Details:      
 
Domain Number 2 Region: 134-392
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000146
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023727   Gene: ENSOCUG00000024444   Transcript: ENSOCUT00000026543
Sequence length 425
Comment pep:novel chromosome:oryCun2:10:14996668:15008460:-1 gene:ENSOCUG00000024444 transcript:ENSOCUT00000026543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPGLLLFLLCLLPLLLQASGPSQAPRDQPQWALLEQHCHGTPALTHLPGPDSYCNTTLDQ
IGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWALRINYSQCEPIFDDKQ
RKYDLHYRIALVVNYLGHCVSMAALVAAFLLFLALRSIRCLRNVIHWNLITTFIRRNVAW
FLLQLIDHEVHESNEVWCRCITATFNYFVVTNFFWMFVEGCYLHTAIAMTYSTERLRKWL
FLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNI
VRILMTKLRASTTSETMQYRKAVKATLVLLPLLGITYMLFFINPGEDDLAQIVFIYFNSF
LQSFQGFFVSVFYCFFNGEVRSALRKRWHRWQDHHSLRVPVARGMSIPTSPTRISFHSIK
HTAAV
Download sequence
Identical sequences 9986.ENSOCUP00000025665 ENSOCUP00000023727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]