SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024708 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024708
Domain Number 1 Region: 165-467
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.19e-57
Family Protein kinases, catalytic subunit 0.0008
Further Details:      
 
Domain Number 2 Region: 2-117
Classification Level Classification E-value
Superfamily DEATH domain 2.16e-27
Family DEATH domain, DD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024708   Gene: ENSOCUG00000014492   Transcript: ENSOCUT00000026320
Sequence length 609
Comment pep:novel chromosome:oryCun2:4:45035613:45099593:1 gene:ENSOCUG00000014492 transcript:ENSOCUT00000026320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGAACGSPAAESPHTLLFDLPPTLLGELCAVLDSCDGAMGWRGLAERLSNSWLDVRLIEK
YVDQGKSGTRELLWSCAQKNKTIGDLLQILQEMGHHRAIHLITNHGTALNPSKQSHQKER
FPNMPAKVKQTCQERRLRTLEEAANVTVGDVLISEHNKKGMLLKSSISFQNVVEGTKNFH
KDFLIGEGEIFKVYRLEIQNRTYAVKLFKQEKWRQEKKQWKKFLSELEVLLLFHHPNILE
LAAYFAEAEQFCLVYPYMRNGTLLDRLQCIGDTAPLSWDVRISILVGISRAILYLHNIQP
CSVICGSISSANILLDDKCEPKLTDFAMAHFRSHLEHQSSTISVASSSTRHLWYMPEEYI
RQGKLSVKTDIYSFGIVIMEILTGCRVVLDDPKHIQLRDLLMELMEKRGLDSCFSLLDKK
VSPCPRNFSAKLFSLAVQCAATRAKLRPSMDEVLNALESAQASLYFAEDPPMSLKSFRCP
SPLFLDNVPSIPMEDDENQNHHSPPHDKSLQEDRMTEKTPFECSQSEVTFLGLDRNTGSK
IPKDTFNTPISCEERWLPEHAVPSQDLGASEIHTSSSSDAPDHSCRSRPVGASCSSQVFL
TKHEQYKNE
Download sequence
Identical sequences ENSOCUP00000024708 9986.ENSOCUP00000024708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]