SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024859 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024859
Domain Number 1 Region: 611-871
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.21e-81
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 277-379
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000523
Further Details:      
 
Domain Number 3 Region: 495-596
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000684
Further Details:      
 
Domain Number 4 Region: 384-485
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 5 Region: 164-270
Classification Level Classification E-value
Superfamily SRCR-like 9.42e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 
Domain Number 6 Region: 96-168
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-16
Family Kringle modules 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024859   Gene: ENSOCUG00000013625   Transcript: ENSOCUT00000027195
Sequence length 872
Comment pep:novel chromosome:oryCun2:15:31394096:31466142:1 gene:ENSOCUG00000013625 transcript:ENSOCUT00000027195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFARLVVALILGALSEVASFDPVLGYPLHRRHRPRSPLDPQDTYFLPDQRQQQSTPPPP
LVPRPPRALLAPRLHALQAGHTPRPHPGGCPASQSWVNVTDFGAPCLRWAEVPPFLERSP
PAGWVHLRGQRHNFCRSPDGAGSPWCFYGNVHGKVDWGYCDCRYGSVRLRGGRNEFEGTV
EVYAGGAWGAVCSSHWDDSDASVICHQLQLGGKGIAKQTSFSVLGLIPIYWSNVRCRGDE
ENILLCEKDMWQGGPCPHKMAAAVTCSSYHGAALPIIRLAGGSTVHEGRVELYHAGQWGT
ICDDQWDDADAEVICRQLGLSGIAKAWNQAYFGEGSGPIMLDEVRCTGNELSIEQCPKSS
WGEHNCGHKEDAGVSCTPLTDGVIRLAGGKSSHEGRLEVYYRAQWGTVCDDGWTELNTYV
VCRQLGFKYGKQASANHFEESAGPIWLDDVSCSGKETSFLQCSRRQWGRHDCSHREDVAV
ACYPGSDGHRLSLGFPIRLVDGENKKEGRVEVFISGQWGTICDDGWTDKDATVICRQLGY
KGPARARTMAYFGEGKGPIHVDNVKCTGSERSLADCIKQDIGKHNCRHSEDAGVICDYFG
KKASSNGDKKSLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGA
TLLSSCWVLTAAHCFKRYGNNTRNYAVRVGDYHTLVPEEFEEEIGVQQIVIHKEYQPHSS
DYDIALVQLQGSQEQCVRFSSHVLPACLPFWRERPQKTASNCYITGWGDTGRAYSRTLQQ
AAVPLLPKRFCEERYKGQFTGRMLCAGNLHEHQRVDSCQGDSGGPLVCERSGGSWVVYGV
TSWGYGCGVKDSPGVYTRVSSFVPWIKSVTKL
Download sequence
Identical sequences 9986.ENSOCUP00000011728 ENSOCUP00000024859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]