SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025095 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025095
Domain Number 1 Region: 345-603
Classification Level Classification E-value
Superfamily Kelch motif 7.06e-39
Family Kelch motif 0.00082
Further Details:      
 
Domain Number 2 Region: 41-166
Classification Level Classification E-value
Superfamily POZ domain 1.79e-33
Family BTB/POZ domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025095   Gene: ENSOCUG00000006712   Transcript: ENSOCUT00000006709
Sequence length 681
Comment pep:novel chromosome:oryCun2:7:60585338:60587380:-1 gene:ENSOCUG00000006712 transcript:ENSOCUT00000006709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSREDAPRPHCLASARGGRRPATTSKASVSAFFTGPEELQDSAHSAALLAQLKSFYDAR
LLCDVTIEVVSPGCGPGTGRLFPCNRNVLAAACPYFRSMFTGGMHESQQARVTLHDVDAA
SFEALVEYCYTGRVSLSEANVQRLYTASDMLQLEYVREACASFLARRLDLANCTAILKFA
DAFGHPSLRSQAQAYIARNFKQLSGMSSVREESLADLTLAQLLAILRLDSLDVASELTVC
HVALQWLEAAPEERGPSAAEVFRCIRWSLFTEGDWSYLEGLLTKPIVRKYCLDVIEGARR
MRCGNMLCKALGPVPDSGTSSRSSSSLVSAGENPPQRLGMCAKEMVVFFGHPRNPFLCYD
PYSGDMYTMPSPLTTVARTKTITSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLAD
CLLCREGMDVAYLNGYIYILGGRDPVTGVKLKEVECYSVQRNQWALVAPVPHSFYSFELL
VVQNYLYAVNNKRMLCYDPSHNLWLSCASLNCSDFQEACVFNDEIYCICDIPVMKVYNPA
RGEWRRIQNIPLDSEVHNYQIVNHDRKLLLVTSTSPQWIKNRVTVYEYDTRGDQWVTVGA
MLGLLQFESGFICLCARVYPSCLVPGQSFITEDDDAQSESSTEWDLDVLSEPDSESGSSS
SFSDAEVWVQVAPQRSAQDQQ
Download sequence
Identical sequences G1U6P8
ENSOCUP00000025095 ENSOCUP00000025095 9986.ENSOCUP00000025095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]