SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025128 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025128
Domain Number 1 Region: 1944-2102
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.82e-56
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000978
Further Details:      
 
Domain Number 2 Region: 1784-1943
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.98e-53
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000436
Further Details:      
 
Domain Number 3 Region: 1455-1637
Classification Level Classification E-value
Superfamily Cupredoxins 5.49e-47
Family Multidomain cupredoxins 0.0000193
Further Details:      
 
Domain Number 4 Region: 31-203
Classification Level Classification E-value
Superfamily Cupredoxins 1.06e-44
Family Multidomain cupredoxins 0.0000000933
Further Details:      
 
Domain Number 5 Region: 350-534
Classification Level Classification E-value
Superfamily Cupredoxins 2.06e-43
Family Multidomain cupredoxins 0.000059
Further Details:      
 
Domain Number 6 Region: 541-666
Classification Level Classification E-value
Superfamily Cupredoxins 5.83e-35
Family Multidomain cupredoxins 0.0002
Further Details:      
 
Domain Number 7 Region: 207-329
Classification Level Classification E-value
Superfamily Cupredoxins 1.98e-32
Family Multidomain cupredoxins 0.00000111
Further Details:      
 
Domain Number 8 Region: 1647-1783
Classification Level Classification E-value
Superfamily Cupredoxins 4.85e-31
Family Multidomain cupredoxins 0.000000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025128   Gene: ENSOCUG00000026781   Transcript: ENSOCUT00000025811
Sequence length 2103
Comment pep:novel chromosome:oryCun2:13:21654092:21723841:-1 gene:ENSOCUG00000026781 transcript:ENSOCUT00000025811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPGCPHLWVLLVLGTSWAGWGSQGTEAARIRQFYVAAQAISWSYRPELTNLSLNTSGTS
FKKIVYREYEAYFKKEKPQSSISGLLGPTLYAEVGDIMKVHFKNKADKPLSIHPQGIKYS
KFSEGASYPDHTFPVEKMDDAVAPGQEYTYEWTISEDSGPTHDDPPCLTHIYYSYDDLIQ
DFNSGLIGPLLICKKGTLAEDGTQKLFDRQHVLLFAVFDESKSWSQSSSLMYTVNGYVNG
TMPDITVCAHDHISWHLIGMSSGPELFSIHFNGQVLEQNHHKLSAITLVSATSTTANMTV
SSEGRWIISSFIPKHFQAGMQAYLDIKNCPKKTRSPKKLTRDQRRHIKRWEYFIAAEEVI
WDYAPIIPANMDKKYRSLHLDNFSNQIGKHYKKVVYKQYQDENFTKRMDNPNIKEDGILG
PIIRAQVRDTLKIVFKNSASRPYSIYPHGVTLSPYEVEVNSSSSSSGNKTVTRAVQPGET
YIYKWNILEFDEPTENDAQCLTRPYYSDVDITRDIASGLIGLLLICKSRSLDKRGIQRAA
DIEQQAVFAVFDENKSWYLEDNINKFCENPDEVKRDDPKFYASNIMSTINGYVPESIPIL
GFCFDDTVQWHFCSVGNQDDILTIHFTGHSFIYGKRHEDTLTLFPMRGESVTVTMDNVVG
TWMLTTVNSGPRSKNLRLRFRDVKCNRDDDDDSYEIYQPPTSSPIDTRKMRDSSENRDEE
YDAEYDYQNSLASSLGIRSFRNSSLNQEEEELNLTALALEGSSEVISASTGAALGSNSSS
PRNISRLMVDNLTGPQKTFPHSGSAGAGSPLRHHGGLDNDSVLNSSTKESSPYSEDPIED
PSQSDITGIHLLPLEAEQSRSQEHAEHKGSKVQRDRAAKHMFSWMELPTHKLEKHSNQNN
ASPSRMEPWENIPSALLLLKQKDPSKILNGKWHVASEKGNYEIIQDADEDVAPKKMLNGS
QGASRAWEEHTPFTNKPRKHSGHTFPGFKHTSLRAEQGGGNRRPKKSPFSIKTRKKKKEE
KLVHYVPLSPRSFRPLTGETDTRLEHSLFPHKYKDTSLPTDLNQTSPSVNVDMIASLLDH
NQNPPNGPGQTSSPPDLYQMVSPEEHHQTFPTQNPDQMYLTTVPSHRSSPLQLTQMPHYD
ISFESFPTESNQMSPSLEREIGQTTISPDLSQSASSLDIGQVPLSPDLDQGTSFPDLSQM
PLSPDLDQGTSFPDLGQMPLSPDLDQGTSFPDLSQMPPSPDLDQGTSFPDLNQMPPSPNL
DQETSSPDLGQMPSSPDLGQMPLSPDLDQGTSFPDLGQMPLSPDLDQGTFFPDLGQVTLS
PNISPTILSTPSSLPDIDQTSYPSESGQPLPFPESGQTVVYPDLSHMPSPSSAPILNDTF
KEVNPLVVVGVSGDDGDYIEIIPRQEVQSEEDDSSEIDYVSYDDPYKTDLRTDINSSRNP
DSIAAWYLLRSNNGNRRNYYIAAEEISWDYSKFAQRYGDDMHNEDADDIPKATVYKKVVF
RKYLDSTFTRRDPQGENEDHLGILGPVIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKS
SEGKTYEDDSPEWFQEDNAIQPNCSYTYVWHATQRSGPESPGSACRAWTYYSAVNSEKDI
HSGLIGPLLVCRKGTLHKASNMPVDRREFILLFMVFNEKKSWYYEKKSKTSWRPSSEVKN
PYEFHAINGMIYSLPGLRMYEQEWVRLHLLNMGGSKDIHVVHFHGQTLLENGTQQHQLGV
WPLLPGSFNTVEMKASKPGWWLLDTEVGENQRLGMQTPFLIIDKECKQPLGLSTGAIADS
QIKASEYLGYWEPRLARLNNGGSYNAWSIEKTTVESAWKTWIQVDMQREVVITGIQTQGA
KHYLKSCYITEFCVAYSSDQTNWKIFKGNSTRNVMYFNGNSDASTTKENLFDPPIVARYI
RISPIRSYNRPALRMELLGCEVNGCSAPLGMESGKIENKQITASSFKKSWWGDYWEPSLA
RLNAQGRVNAWQAKANNNIQWLQIDLLKIKKITAIATQGCKSLSSEMFVRSYTIHYSDKG
VDWKAYRQKSSTADKIFEGNSNTKGQVKNFFNPPIISRFIRIIPKTWNQSIALRLELFGC
DVY
Download sequence
Identical sequences ENSOCUP00000025128 9986.ENSOCUP00000025128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]