SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025579 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025579
Domain Number 1 Region: 172-297
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-36
Family Pleckstrin-homology domain (PH domain) 0.00000184
Further Details:      
 
Domain Number 2 Region: 400-504
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-24
Family SH2 domain 0.00000423
Further Details:      
 
Domain Number 3 Region: 12-72
Classification Level Classification E-value
Superfamily Phenylalanine zipper 6.54e-22
Family Adapter protein APS, dimerisation domain 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025579   Gene: ENSOCUG00000022082   Transcript: ENSOCUT00000010356
Sequence length 580
Comment pep:novel scaffold:oryCun2:GL019215:8175:18926:1 gene:ENSOCUG00000022082 transcript:ENSOCUT00000010356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGAGPGPAPVPDWREFCELHAQVAAVDFAHKFCRFLQEHPAYDTPDAGASFSRHFAANF
LDAFGEEVRRVLVAGPAARGTAERTAAMEPGPAGTPAIKAAAHGHSRSSEDVSTHAAAKA
RVRKGFSLRNMSLCVVDGVRDMWHRRASPEPDATPRAAAEPQAEPRDKWTRRLRLSRTLA
AKVELVDIQREGALRFMVADAGQWQKCRLLLRRAVAGERFRLEFFVPPKASRPKVSIPLS
AVLEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDPVDSEEDT
ELACARGGCVASRVASCSCELLTDAADLPRPPETAAPAVVTAPHSRARDGLAESLGHVPL
ETFLQTLEPPGGGGGDSGNAAGEEGAEADPEAEPQLELSDYPWFHGTLSRVKAAQLVLAG
GPRSHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVLDMLRHF
HTHPIPLESGGSADITLRSYVRAQGPPAPEPGPSPRARSARAAAATAPSACWTQPCGLKA
GPEGPLGTAPPTAPPGATGESKASDETSRPRSSRPRPALG
Download sequence
Identical sequences ENSOCUP00000025579 9986.ENSOCUP00000025579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]