SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026077 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000026077
Domain Number 1 Region: 562-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-26
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-25
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 1-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 606-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 657-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000398
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 8 Region: 356-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000538
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000026077
Domain Number - Region: 191-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0345
Family Classic zinc finger, C2H2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000026077   Gene: ENSOCUG00000029054   Transcript: ENSOCUT00000033052
Sequence length 688
Comment pep:novel chromosome:oryCun2:1:75577965:75589516:-1 gene:ENSOCUG00000029054 transcript:ENSOCUT00000033052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQASVSFKDVSVEFTLEEWQHVSPAQRTLYRDVMLENYSHLVSLGYCFTKPGLIFILEQG
EDPWLLDKEFLSRSSPEDFQPDELSEKSPENQDKYLWPLLFTNKSLTTSQEISCNLDMNH
FTARMTPCKCGAAGATYLGASPLSPQSLCSREEAHELNLCEKWLLNIKNCRTNTCGKGFV
YNKNIKALSLKEQVIQHQKIQNLGQAFKYNESGKDFFGKTVLITSQSAHRKVKSYKLNKP
GENQCAKSTFIVSQSIHPEKSHCEFNENGNSFNRTTQKTDTKGKSTSQKSHIGDHERIHT
EVKHGAYGKKLNHNSALLLCQGTHTSDQSSDDSTRTETSTYQPTFSVHQRTNVRAKPNEC
NEYGNCCSLNSCVIHTQKSPPGEKPYECHECGKAFSEKSRLRKHQRTHTGEKPYKCEGCE
KAFSAKSGLRIHQRTHTGEKPFECNDCGKSFNYKSILIVHQRTHTGEKPFECNDCGKSFS
HMSGLRNHRRTHTGERPYKCDECGKAFKLKSGLRKHHRTHTGEKPYKCSQCGKAFGQKSQ
LRGHHRIHTGEKPYKCNHCGEAFSQKSNLRVHHRTHTGEKPYKCDECGKTFRQKSNLRGH
QRTHTGEKPYECSDCGKAFSEKSVLRKHQRTHTGEKPYHCNQCGEAFSQKSNLRVHQRTH
TGEKPYKCDKCVKTFSQKSSLREHQKSH
Download sequence
Identical sequences ENSOCUP00000026077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]