SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|451948154|ref|YP_007468749.1| from Desulfocapsa sulfexigens DSM 10523

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|451948154|ref|YP_007468749.1|
Domain Number 1 Region: 57-112
Classification Level Classification E-value
Superfamily HMG-box 0.0000055
Family HMG-box 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|451948154|ref|YP_007468749.1|
Sequence length 205
Comment ABC-type transport system involved in resistance to organic solvents, auxiliary component [Desulfocapsa sulfexigens DSM 10523]
Sequence
MIRKRLVFLLVYFVIFCAHVAVASSSPTDSLRPTLEGVIDVIRDPNLAGVDHKKVRREKV
MAIATRGFDFTEMSKRALGATWRDLSQEERQYFEELFTKLLENAYIGKLEGYSGQEIVYQ
DERIKGNRAAVATIVKSSDTAPFSVSYVMLQSGSDWLVYDLNIEGVSFLRNYSEQFKSIL
RKDKFAGLVKILEEKNETFEKEESN
Download sequence
Identical sequences M1PRW5
WP_015404782.1.24328 gi|451948154|ref|YP_007468749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]