SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000833 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000833
Domain Number 1 Region: 2-235
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.31e-80
Family Proteasome subunits 0.00000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000833   Gene: ENSOGAG00000000931   Transcript: ENSOGAT00000000932
Sequence length 248
Comment pep:novel scaffold:OtoGar3:GL873542.1:21210191:21218278:-1 gene:ENSOGAG00000000931 transcript:ENSOGAT00000000932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKHYTDDA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
Download sequence
Identical sequences H0WHI5
ENSOGAP00000000833 XP_003787803.1.62490 ENSOGAP00000000833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]