SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002171 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002171
Domain Number 1 Region: 63-220
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.25e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002171   Gene: ENSOGAG00000002430   Transcript: ENSOGAT00000002433
Sequence length 225
Comment pep:novel scaffold:OtoGar3:GL873570.1:4102032:4117452:-1 gene:ENSOGAG00000002430 transcript:ENSOGAT00000002433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LISKNKGSYLSLLFGRASATLGLSSTEDEGEDPWYQKACKCDCQGGANALWSTSATSLDC
IPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDS
SQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGN
SDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
Download sequence
Identical sequences H0WKQ2
ENSOGAP00000002171 ENSOGAP00000002171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]