SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000002983 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000002983
Domain Number 1 Region: 143-289,328-343,422-464
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.03e-53
Family Hemopexin-like domain 0.00061
Further Details:      
 
Domain Number 2 Region: 21-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000183
Family Somatomedin B domain 0.0000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000002983   Gene: ENSOGAG00000003343   Transcript: ENSOGAT00000003346
Sequence length 470
Comment pep:novel scaffold:OtoGar3:GL873631.1:1911203:1913860:1 gene:ENSOGAG00000003343 transcript:ENSOGAT00000003346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASARPFLMLALLAWVVLADQDSCKGRCTEGFNADRKCQCDELCSYYQSCCADYMAECKH
QVTRGDVFTLPEDEYRDYDYPIEETKENSSLHTQPEAASLGPEVQAQTEWYTVQPSLLNP
REDISKPEVNLKPETLDPETSESPAEEVCSGKPFDAFTDLKNGSLFAFRGKYCYELDETA
VRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFDDGVLDPDYPRNISEGF
NGIPDNIDAALALPAHSYSGRERVYFFKGKQYWEYQFQQQPSQEECEGGSLSAVFEHFAL
LQRDSWESIFEFLFWGRHFGGTGEPQFISQDWHGVPGKVDAAMAGRIYISGAAPRSSWAK
KQKSRRRSRKRYRSRGSRGRSQNSRRSSRSTFLSSLFSSEESGLGAYNYADYGMDWLVPA
TCEPVQSVFFFSGDKYYRVNLRTRRVDTVNPPYPRSIAQYWLGCPTPSQE
Download sequence
Identical sequences H0WMK9
ENSOGAP00000002983 XP_003797209.1.62490 ENSOGAP00000002983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]