SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003130 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003130
Domain Number 1 Region: 6-236
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.59e-65
Family Proteasome subunits 0.00000000692
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003130   Gene: ENSOGAG00000003513   Transcript: ENSOGAT00000003516
Sequence length 277
Comment pep:novel scaffold:OtoGar3:GL873533.1:27231047:27291506:-1 gene:ENSOGAG00000003513 transcript:ENSOGAT00000003516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSVYKPPVGGFSFDNCRRNAVLEADFAKKGYKLPKARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEDDAKKLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYSVPNKKGT
RFGRYRCEKGTTAVLSEKVTTLEIEVLEETVQTMDTS
Download sequence
Identical sequences H0WMX5
ENSOGAP00000003130 XP_003785342.1.62490 ENSOGAP00000003130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]