SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003600 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003600
Domain Number 1 Region: 47-259
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.24e-60
Family Proteasome subunits 0.00000000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003600   Gene: ENSOGAG00000004041   Transcript: ENSOGAT00000004042
Sequence length 264
Comment pep:novel scaffold:OtoGar3:GL873693.1:1544718:1546935:-1 gene:ENSOGAG00000004041 transcript:ENSOGAT00000004042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFLEPWSGLWAGGPAPGQFYRIPCTPSSSMDPASALSGRPITRTLNPMVTGTSVLGVK
FEGGVVIAADMLGSYGSLARFRNISRIMKVNDSTMLGASGDYADFQYLKQVLGQMVIDEE
LLGDGHSYSPKAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAP
SLATGYGAYLAQPLLREVLEKQPVLSQTEAQELVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSAETNWDIAHMISGFE
Download sequence
Identical sequences H0WP11
ENSOGAP00000003600 ENSOGAP00000003600 XP_003800419.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]