SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004092 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004092
Domain Number 1 Region: 102-279
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.53e-57
Family F-box associated region, FBA 0.000055
Further Details:      
 
Domain Number 2 Region: 15-79
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000497
Family F-box domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004092   Gene: ENSOGAG00000004586   Transcript: ENSOGAT00000004588
Sequence length 283
Comment pep:novel scaffold:OtoGar3:GL873752.1:1818754:1823380:1 gene:ENSOGAG00000004586 transcript:ENSOGAT00000004588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASASRGQVARIPAPEPEPEEAALGLNQLPPELLLVVLSYVPPRTLLRSCRHVCRGWRA
LVDGQALWFLILARDHGATGRALLPLVRSCLPPARNGRLCPLGRFCLRRPIGRNLIWNRG
GQEGLRKWMVRQGGNGWLVEENGPAVPGAPSQSFGTSFRWCLKKEFLDLEEEGLWPELLD
SGKIEICVSEWQRARDGSTCVYRLLVQLLDANQTVLDTFSAVPDPSQQWNNNSCLWVTHV
FSNIKMGVRLVSFEHWGEETRFWAGDYEARVTNSSVIVRLCLS
Download sequence
Identical sequences H0WQ78
ENSOGAP00000004092 ENSOGAP00000004092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]