SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004884 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004884
Domain Number 1 Region: 141-410
Classification Level Classification E-value
Superfamily EndoU-like 8.24e-95
Family Eukaryotic EndoU ribonuclease 0.00000576
Further Details:      
 
Domain Number 2 Region: 21-61
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000458
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 92-131
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000392
Family Somatomedin B domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004884   Gene: ENSOGAG00000005458   Transcript: ENSOGAT00000005461
Sequence length 416
Comment pep:novel scaffold:OtoGar3:GL873589.1:8057328:8074441:-1 gene:ENSOGAG00000005458 transcript:ENSOGAT00000005461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVYIPLIVTLLCGLAWAGKLESCASRCKEKFNQDAACQCDHQCPRHGDCCEDYEHLCTA
AEDLEEPEPFLELEEEEEAEEAPASHLYSAPTSCRGRCRQAFDKHQPCHCNARCQEFGNC
CEDFESLCGDHEGFSHSSDTITKEELQTISEKIYGADTNKAQKEDIILNSQKCISPSETR
DRVDRCPEPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQQLAEQDTFLREIM
KTAVMKELYSFLHHQNRYSSEQEFVSDLKNMWFGLYSRGDEKGDSSGFEHVFSGEVKKGK
VTGFHNWIRFYLQEKEGLVDYYSYVYDGPWDSYPDVLAMQFNWDGYYKEVGAAFIGSSPE
FEFALYSLCFIARPGKACKLSLGGHPLAIQTYSWDKSTYGNGRKYIATAYVVSSTR
Download sequence
Identical sequences H0WS44
ENSOGAP00000004884 ENSOGAP00000004884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]