SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005773 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005773
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000281
Family Proprotein convertase P-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005773   Gene: ENSOGAG00000006453   Transcript: ENSOGAT00000006457
Sequence length 227
Comment pep:known scaffold:OtoGar3:GL873627.1:7198411:7225087:1 gene:ENSOGAG00000006453 transcript:ENSOGAT00000006457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDPNGFNDWTFSTVRCWGERAKGVYRLVVRDVGDESLQVGVLQHWQLTLYGSVWGPVD
IRDRQRLLESAMSGKYLHDGFTLPCPPGLKIPEEDGYTITPNTLKTLVLVGCFTVFWTVY
YMLEIYLSQRNVSSNSLCRNGPCHWPQWSRKAREEGTELESVPLCSSKDLDGVEAESRGP
PPSSGLLARDLPDQGDWNLSQNNKSALDCSHQHQPLHLLQGKEEQIC
Download sequence
Identical sequences H0WU90
ENSOGAP00000005773 ENSOGAP00000005773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]