SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006838 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006838
Domain Number 1 Region: 113-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.79e-47
Family Hypothetical protein AT3g04780/F7O18 27 0.0000575
Further Details:      
 
Domain Number 2 Region: 6-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000258
Family Thioltransferase 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006838   Gene: ENSOGAG00000007641   Transcript: ENSOGAT00000007643
Sequence length 289
Comment pep:novel scaffold:OtoGar3:GL873546.1:18235897:18269093:1 gene:ENSOGAG00000007641 transcript:ENSOGAT00000007643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGVKPVGSDPDFQPELSGAGSRLTVVKFTMRGPSHCINIRQYFESQSKKYNSWPMIHCS
RHCCLGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGCNEDTDIP
KGYMDLMPFINKAGCECLNESDEHGFDNCLRKDLTFLESDCDEQLLITVAFNQPVKLYSM
KFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
VNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH
Download sequence
Identical sequences H0WWR2
ENSOGAP00000006838 ENSOGAP00000006838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]