SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006851 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006851
Domain Number 1 Region: 151-516
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 6.54e-89
Family Phosphonoacetate hydrolase 0.014
Further Details:      
 
Domain Number 2 Region: 623-889
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.53e-35
Family DNA/RNA non-specific endonuclease 0.0081
Further Details:      
 
Domain Number 3 Region: 57-103
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000314
Family Somatomedin B domain 0.0015
Further Details:      
 
Domain Number 4 Region: 105-145
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000034
Family Somatomedin B domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006851   Gene: ENSOGAG00000007652   Transcript: ENSOGAT00000007658
Sequence length 891
Comment pep:novel scaffold:OtoGar3:GL873523.1:10072279:10149607:1 gene:ENSOGAG00000007652 transcript:ENSOGAT00000007658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTSSFRLYQVISLFTFAVGVNICLGFTAHRIKRAEEWDEGPPTVLSDSPWTNTSGSCK
GRCFELQEVGPPECRCDNLCKSYSSCCHDFDEHCLKTARGWECTKDRCGEVRNEDNACHC
SEDCLARGDCCTNYQVICKGESHWVDDDCEEIKAPECPVGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATTKGLYPESHGIVGNSMYDPVF
DATFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDS
ERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKTVGQLMDGLKQLKLHRCVNVIFVG
DHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKAD
QHFKPYMKQHLPKRLHYANNRRIEDIHLLVDRRWHVARKPLDVYKKPSGKCFFQGDHGFD
NKVNSMQTVFVGYGPTFKYKTKVPPFENIELYNVMCVDLLGLKPAPNNGTHGSLNHLLRT
NTFRPTMPEEVARPNYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEVGQA
KFEPTKSQYKENINGYFEPRKERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPLWT
SYTVSKQAEVSGIPEQLASCVRPDVRVSPSFSQNCLAYKNDKQMSYGFLFPPHLSSSPEA
KYDAFLVTNMVPMYPAFKRVWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTEEK
IKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNDESCNSSEDE
SKWVEELMKMHTARVRDIEHLTSLDFFRKTSRNYPEILSLKTYLHTYESEI
Download sequence
Identical sequences H0WWS5
ENSOGAP00000006851 ENSOGAP00000006851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]