SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007428 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007428
Domain Number 1 Region: 97-274
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.91e-63
Family F-box associated region, FBA 0.0000177
Further Details:      
 
Domain Number 2 Region: 7-70
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000164
Family F-box domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007428   Gene: ENSOGAG00000008297   Transcript: ENSOGAT00000008300
Sequence length 278
Comment pep:novel scaffold:OtoGar3:GL873752.1:1872490:1879356:1 gene:ENSOGAG00000008297 transcript:ENSOGAT00000008300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARSSRRLQPADPPMALDTLPPELLVQVLSHVPPRGLVTQCRLVCRAWRDVVDGPTVWL
LHLARDRSAEGRALYALALRCLPNSEEDEEFPFCALARYCLRAPLGRNLIFNSCGERGFK
GWEVEHGGNGWAVEKNLTLVPGAPSQTCFVTSFEWCFKRQLVDLVMEGVWQELLDSAQIE
ICVADWWGARENCGCVYRLRVRLLDVYENEVVKFSASPNPVLQWTERGCRQVSHVFTNFG
KGIRYVSFEQYGRDTRSWVGHYGALVTHSSVKVRIRLS
Download sequence
Identical sequences H0WY61
XP_012668405.1.62490 ENSOGAP00000007428 ENSOGAP00000007428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]