SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008636 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008636
Domain Number 1 Region: 26-220
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.04e-61
Family Proteasome subunits 0.00000000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008636   Gene: ENSOGAG00000009653   Transcript: ENSOGAT00000009655
Sequence length 239
Comment pep:novel scaffold:OtoGar3:GL873565.1:13112150:13114478:1 gene:ENSOGAG00000009653 transcript:ENSOGAT00000009655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLVAARGQGPAPAWGPEAIAPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYI
ANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEM
CYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREG
MTKEECLEFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFTIATLPPP
Download sequence
Identical sequences H0X102
ENSOGAP00000008636 XP_003791250.1.62490 ENSOGAP00000008636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]