SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008681 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008681
Domain Number 1 Region: 68-251
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-74
Family F-box associated region, FBA 0.000002
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 2.75e-16
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008681   Gene: ENSOGAG00000009711   Transcript: ENSOGAT00000009712
Sequence length 255
Comment pep:novel scaffold:OtoGar3:GL873586.1:8261481:8265177:1 gene:ENSOGAG00000009711 transcript:ENSOGAT00000009712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGNINELPESILLELFTHVPARQLLLRCRLVCSLWRDLIDLVSLWKRKCLREGFITED
WDQPVADWKIFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPSE
KVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARRDCGSKYQLCVQL
LSSAHAPLGTFQPDPVTIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYG
PKVTNSSITIGPPLR
Download sequence
Identical sequences H0X139
XP_003793323.1.62490 XP_012662786.1.62490 XP_012662787.1.62490 ENSOGAP00000008681 ENSOGAP00000008681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]