SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011520 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011520
Domain Number 1 Region: 323-691
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.03e-105
Family beta-glycanases 0.000000538
Further Details:      
 
Domain Number 2 Region: 22-211
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-54
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00038
Further Details:      
 
Domain Number 3 Region: 214-324
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000000211
Family beta-Galactosidase/glucuronidase domain 0.0072
Further Details:      
 
Domain Number 4 Region: 800-880
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000302
Family beta-Galactosidase/glucuronidase domain 0.0095
Further Details:      
 
Domain Number 5 Region: 697-796
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000106
Family beta-Galactosidase/glucuronidase domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011520   Gene: ENSOGAG00000012852   Transcript: ENSOGAT00000012855
Sequence length 880
Comment pep:novel scaffold:OtoGar3:GL873622.1:2101180:2214151:-1 gene:ENSOGAG00000012852 transcript:ENSOGAT00000012855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLYLLLLLALWLEGSTAEERSYGLGGRWSIRSGNGSLELSGEVPGCVHSALFQQGLIQD
PYYRFNDLNYRWISLDNWTYSKTFKIPFDISKWQKVNLIFEGVDTVSKILFNNITIGATD
NMFNRYSFDITSLVRDVNCLEVRFQSALSYAAQRSRAHTRYRVPPECPPSVQKGECHVNF
VRKEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLNYFTFSPTYDNSAREWNLEIESSFD
VVSSKSVGGKVIVSIPKLQTNQIYNLELQPGERIVELFVKINKNVTVETWWPHGHGNQTG
YNMTVLFELDGGVTIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNWIPA
DAFQDRVTSDVLRLLLQSAVDANMNTLRVWGGGIYEQDEFYQLCDELGIMIWQDFMFACA
LYPVDRDFIDSVRAEVAYQIRRLKSHPSIIIWSGNNENEAALMTNWYHISPVDLHTYIND
YVTLYVKNIREMVLAGDKSRPFIISSPTNGVETIAEGWVSHDPYSNYFGDVHFYDYFSDC
WDWKVFPKARFASEYGYQSWPSFSTLEKKVSSKKDWSFNSKFSLHRQHHEDGNKQMLHQA
QLHFKLPQSTDPLRAFKDTIYLTQVMQAQCVKTETEFYRRSRSEIVNKKGHTMGALYWQL
NDIWQAPSWASLEYGGKWKMLHYFARRFFAPLLPVGFEDQSVFHVYGVSDLHSDLRVMLT
VRVHTWSSLEPLCSLATKGFVIRAGKAILLYKEPVSSLLRRCGHCTRKSCVVSFYLSNDL
ELLSPINHHFLSSLKEAVGLRRAHITAIISQQGDTFVFDLETSAVAPFVWLDVGSIPGRF
SDNGFLMTEKTRSISFYPWKPTSKSELERSLRVTSLTDIY
Download sequence
Identical sequences H0X7V6
ENSOGAP00000011520 ENSOGAP00000011520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]