SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011620 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011620
Domain Number 1 Region: 124-656
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.93e-125
Family Gamma-glutamyltranspeptidase-like 0.000000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011620   Gene: ENSOGAG00000012970   Transcript: ENSOGAT00000012971
Sequence length 662
Comment pep:novel scaffold:OtoGar3:GL873544.1:16779933:16805580:-1 gene:ENSOGAG00000012970 transcript:ENSOGAT00000012971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESEASQESALGAYSPVDYMSITSFPRLPEDEPAPAAPLRGRKDEDAFLGDPDTDPDS
FLKSARLQRLPSSSSEMGSQDGSPLRETRKDPFSAAASECSCRQDGLTVIVTACLTFATG
VTVALVMQIYFGDPQIFQQGAVVTDAARCTSLGIEVLSKQGSSVDAAVAAALCLGIVAPH
TSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREETLQRSWETKPGLLVGVPGMVKGLH
EAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLARALADQLPPNVSERFREMFLPLGRPPL
PGSLLYRPDLAEVLDALGTSGPAAFYAGGNLTLEMVAEAQHAGGVITEEDFSNYSALVEK
PVCGVYRGHLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALAS
RLGDPVYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTAAQVLIMG
PDDFIVAMVSSLNQPFGSGLITPSGILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPL
SFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNRNLSDSLARGRLHPDL
QSNLLQVDSEFTDEEIEFLEARGHHVEKVDVLSWVHGSRRTNNFIIGVKDPRSPDAAGAT
IL
Download sequence
Identical sequences H0X844
ENSOGAP00000011620 XP_003788164.1.62490 ENSOGAP00000011620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]