SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011667 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011667
Domain Number 1 Region: 312-356,395-622
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.92e-27
Family N-type ATP pyrophosphatases 0.01
Further Details:      
 
Domain Number 2 Region: 1-187
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000000000000054
Family Class II glutamine amidotransferases 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011667   Gene: ENSOGAG00000013025   Transcript: ENSOGAT00000013027
Sequence length 631
Comment pep:novel scaffold:OtoGar3:GL873714.1:2299091:2303129:1 gene:ENSOGAG00000013025 transcript:ENSOGAT00000013027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGICCSVSFSAENFSKELKEDLLYNLMRRGPNISKQLSKSDGSYQCLFSGHVLHLRGVL
TAQPLEDERGNVFLWNGEVFSGIKVEAEENDTQIMFNYLSSCEDESDILSLFSKVQGPWS
FIYYQASSHYLWFGRDFFGRRSLLWHFSNLGKSFCLSSVGTQTSGVANEWQEIPASGVFR
IDLKSTTITRCVVLKLYPWKYISRENIVEECVNSLTQISADLPAFVSVVLNEAKLFLEKP
VVPLNMLLPQAPLETHCSSNASIPPTRETLQAFLADGHTKEVVQQFIHVLSVAVKRRILY
LPRDENLAPNEVLKMCERKANVAILFSGGIDSMVIAALADCHIPLDEPIDLLNVAFMTEK
KTIPTNCNKKRSKQKNHHEIPSEDFTKNVAATDDDSPYKQFSVPDRITGRAGLKELQVIN
PSRIWNFVEINVSLEELQELRRTQICHLIRPLDTVLDDSIGCAVWFASRGIGWLVTQDKV
KSYQSSAKVVLTGIGADEQLAGYSRHRVRFQAHGLEGLNKEIMMELGRISSRNLGRDDRV
ISDHGKEARFPFLDENVVSLLNSLPVWEKANLTLPRGVGEKLILRLAAVELGLTASALLP
KRAMQFGSRIAKIEKNDEKASDKCGRLQIIS
Download sequence
Identical sequences H0X881
ENSOGAP00000011667 ENSOGAP00000011667 XP_003801082.2.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]