SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012152 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012152
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.61e-91
Family Proteasome subunits 0.00000000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012152   Gene: ENSOGAG00000013560   Transcript: ENSOGAT00000013562
Sequence length 241
Comment pep:novel scaffold:OtoGar3:GL873529.1:2047559:2075758:1 gene:ENSOGAG00000013560 transcript:ENSOGAT00000013562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLME
PSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA
LQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSS
LQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
Download sequence
Identical sequences A0A061IPM3 A0A096MPG3 A0A0D9S6J3 A0A0P6CSU2 A0A109NGN6 A0A1S3A4S9 A0A1S3GET8 A0A1U7QLW1 A0A1U7UQ21 A0A250YD89 A0A287CZU6 A0A2I2UNM4 A0A2I3GAD4 A0A2K5EDG7 A0A2K5IAS3 A0A2K5M1D8 A0A2K5PNS4 A0A2K5YST6 A0A2K6CAI9 A0A2K6MMY7 A0A2K6QU29 A0A2K6U6K2 F2Z5K2 F6VEA3 F7HY95 G1LDQ6 G3TIB8 G5BQW4 G7NV55 H0VP94 H0X9C6 H2N6I5 I0FTI7 K7DL30 K9IZ68 L5K2D7 M3XVQ6 P28066 Q3UPK6 Q5E987 Q6P9V6 Q9Z2U1 W5QD30
ENSCPOP00000012309 ENSPCAP00000009108 ENSGGOP00000006420 ENSCJAP00000005466 ENSMPUP00000003156 ENSSSCP00000007285 ENSLAFP00000014380 ENSPPYP00000001247 ENSTTRP00000009061 ENSFCAP00000016865 3unb_D 3unb_R 3unb_f 3unb_t 3une_D 3une_R 3une_f 3une_t 3unf_D 3unf_R 3unh_D 3unh_R 5a0q_E 5a0q_S 5gjq_F 5gjq_l 5gjr_F 5gjr_l 5l4g_E 5l4g_R 5le5_D 5le5_R 5lex_D 5lex_R 5ley_D 5ley_R 5lez_D 5lez_R 5lf0_D 5lf0_R 5lf1_D 5lf1_R 5lf3_D 5lf3_R 5lf4_D 5lf4_R 5lf6_D 5lf6_R 5lf7_D 5lf7_R 5ln3_E 5m32_D 5m32_R 6avo_H 6avo_M ENSSSCP00000007285 ENSMUSP00000088057 ENSP00000271308 ENSCPOP00000012309 ENSECAP00000009883 ENSBTAP00000027507 ENSGGOP00000006420 ENSOARP00000020628 ENSSTOP00000010068 NP_001015566.1.59421 NP_001015566.1.76553 NP_001138373.1.46622 NP_001247538.1.72884 NP_002781.2.87134 NP_002781.2.92137 NP_036097.1.92730 NP_058978.2.100692 NP_058978.2.4139 XP_001918089.1.31192 XP_002751222.1.60252 XP_002810542.1.23681 XP_002919250.1.58354 XP_003267940.1.23891 XP_003479251.1.53824 XP_003511013.1.69978 XP_003639184.1.84170 XP_003784116.1.62490 XP_003933451.1.74449 XP_003990451.1.62641 XP_004002329.1.66739 XP_004263180.1.21590 XP_004328504.1.83887 XP_004388088.1.4749 XP_004407244.1.74151 XP_004420787.1.5094 XP_004620110.1.94378 XP_004636986.1.9945 XP_004659101.1.11716 XP_004689754.1.23501 XP_004769753.1.14098 XP_004853686.1.39548 XP_005076701.1.91757 XP_005338139.1.77405 XP_005367944.1.66349 XP_005388910.1.28644 XP_005542534.1.63531 XP_005891376.1.15283 XP_006052236.1.26621 XP_006180009.1.101512 XP_006197462.1.17985 XP_006899396.1.29581 XP_006919661.1.64745 XP_006979536.1.50099 XP_007076490.1.5354 XP_007106529.1.24612 XP_007169527.1.59432 XP_007449384.1.90284 XP_007529390.1.11023 XP_007624626.1.28591 XP_007947933.1.48129 XP_007975894.1.81039 XP_008067961.1.4292 XP_008145334.1.99482 XP_008521674.1.77740 XP_008564715.1.73410 XP_008702233.1.72690 XP_008848617.1.79516 XP_009428174.2.37143 XP_010353751.1.97406 XP_010587839.1.64505 XP_010829214.1.44457 XP_010946545.1.22495 XP_010974207.1.51371 XP_011366145.1.92234 XP_011735542.1.29376 XP_011803515.1.43180 XP_011824103.1.47321 XP_011933648.1.92194 XP_011979436.1.54773 XP_012323478.1.9421 XP_012607029.1.48125 XP_012887373.1.60039 XP_014690706.1.49734 XP_014930773.1.86478 XP_015360588.1.40921 XP_016011110.1.101085 XP_016078912.1.3490 XP_017354744.1.71028 XP_017714263.1.44346 XP_017901347.1.57651 XP_019313292.1.44245 XP_019486187.1.44202 XP_019812481.1.53367 XP_020018647.1.5219 XP_020734222.1.74333 XP_021051692.1.100879 XP_021545634.1.83697 ENSPCAP00000009108 cath|current|3unbD00/1-233 cath|current|3unbR00/1-233 cath|current|3unbf00/1-233 cath|current|3unbt00/1-233 cath|current|3uneD00/9-241 cath|current|3uneR00/9-241 cath|current|3unef00/9-241 cath|current|3unet00/9-241 cath|current|3unfD00/1-233 cath|current|3unfR00/1-233 cath|current|3unhD00/1-233 cath|current|3unhR00/1-233 ENSMMUP00000007662 ENSOGAP00000012152 ENSLAFP00000014380 ENSRNOP00000026928 ENSOGAP00000012152 ENSMMUP00000007662 gi|23110942|ref|NP_002781.2| ENSNLEP00000003464 ENSP00000271308 HGL_H00000271308 ENSRNOP00000026928 ENSNLEP00000003464 ENSAMEP00000005038 ENSMPUP00000003156 10090.ENSMUSP00000088057 10116.ENSRNOP00000026928 10141.ENSCPOP00000012309 9544.ENSMMUP00000007662 9600.ENSPPYP00000001247 9606.ENSP00000271308 9615.ENSCAFP00000029368 9796.ENSECAP00000009883 9823.ENSSSCP00000007285 9913.ENSBTAP00000027507 ENSECAP00000009883 ENSMUSP00000088057 ENSSTOP00000010068 ENSPVAP00000008405 ENSMUSP00000088057 ENSP00000271308 ENSPVAP00000008405 ENSAMEP00000005038 ENSTTRP00000009061 ENSCJAP00000005466 ENSPANP00000001616 ENSBTAP00000027507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]