SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012390 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012390
Domain Number 1 Region: 59-272
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.2e-69
Family Proteasome subunits 0.0000000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012390   Gene: ENSOGAG00000013830   Transcript: ENSOGAT00000013835
Sequence length 276
Comment pep:novel scaffold:OtoGar3:GL873550.1:3741301:3744346:-1 gene:ENSOGAG00000013830 transcript:ENSOGAT00000013835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLDVCGAPRGQRPDWAFPAAGSSHCSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGD
REKDIQIEMAHGTTTLAFKFQHGVIVAVDSRASAGNYIDTLRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVNENGTRLSGNMFSTGSGNTYAYGVMDSGYLLNLTPQEAYDLGRRAIAHATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLLHQYWEAKQ
Download sequence
Identical sequences H0X9X0
ENSOGAP00000012390 ENSOGAP00000012390 XP_003789118.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]